Proteintech, 20809-1-AP, MT2A Polyclonal antibody

Size: 20ul / 150ul The MT2A (20809-1-AP) by Proteintech is a Polyclonal antibody targeting MT2A in IHC, ELISA applications with reactivity to human samples 20809-1-AP targets MT2A in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:100-1:400 Specification Tested Reactivity: human Cited Reactivity: chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14761 Product name: Recombinant human MT2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-61 aa of BC007034 Sequence: MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA Predict reactive species Full Name: metallothionein 2A Calculated Molecular Weight: 61 aa, 6 kDa GenBank Accession Number: BC007034 Gene Symbol: MT2A Gene ID (NCBI): 4502 RRID: AB_2878744 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02795 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.