Proteintech, 20871-1-AP, CCDC88B Polyclonal antibody

Size: 20ul / 150ul The CCDC88B (20871-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC88B in WB, ELISA applications with reactivity to human samples 20871-1-AP targets CCDC88B in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Jurkat cells, NK-92 cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14936 Product name: Recombinant human CCDC88B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1378-1476 aa of BC030194 Sequence: QSSLCLRDETLAGGQRRKLSSRFPVGRSSESFSPGDTPRQRFRQRHPGPLGAPVSHSKGPGVGWENSAETLQEHETDANREGPEVQEPEKRPLTPSLSQ Predict reactive species Full Name: coiled-coil domain containing 88B Calculated Molecular Weight: 1476 aa, 165 kDa Observed Molecular Weight: 165 kDa GenBank Accession Number: BC030194 Gene Symbol: CCDC88B Gene ID (NCBI): 283234 RRID: AB_2935451 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A6NC98 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.