Iright
BRAND / VENDOR: Proteintech

Proteintech, 20871-1-AP, CCDC88B Polyclonal antibody

CATALOG NUMBER: 20871-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCDC88B (20871-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC88B in WB, ELISA applications with reactivity to human samples 20871-1-AP targets CCDC88B in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Jurkat cells, NK-92 cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14936 Product name: Recombinant human CCDC88B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1378-1476 aa of BC030194 Sequence: QSSLCLRDETLAGGQRRKLSSRFPVGRSSESFSPGDTPRQRFRQRHPGPLGAPVSHSKGPGVGWENSAETLQEHETDANREGPEVQEPEKRPLTPSLSQ Predict reactive species Full Name: coiled-coil domain containing 88B Calculated Molecular Weight: 1476 aa, 165 kDa Observed Molecular Weight: 165 kDa GenBank Accession Number: BC030194 Gene Symbol: CCDC88B Gene ID (NCBI): 283234 RRID: AB_2935451 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A6NC98 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924