Proteintech, 20877-1-AP, PKC Epsilon Polyclonal antibody

Size: 20ul / 150ul The PKC Epsilon (20877-1-AP) by Proteintech is a Polyclonal antibody targeting PKC Epsilon in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 20877-1-AP targets PKC Epsilon in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, SH-SY5Y cells, rat brain tissue Positive IP detected in: SH-SY5Y cells Positive IHC detected in: mouse brain tissue, human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: HeLa cells, U2OS cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information PKC Epsilon (Protein kinase C epsilon type) is also named as PKC-ε, PRKCE and PKCE. It belongs to the protein kinase superfamily, AGC Ser/Thr protein kinase family and PKC subfamily. PKC-ε, one of the novel isoforms, as a critical player in membrane mobilization during phagocytosis (PMID: 9069266). KC-ε is tethered to the Golgi through binding of its pseudosubstrate domain to phosphatidylinositol-4-phosphate (PI4P) (PMID: 28539432). PKC-ε traffics on microtubule-associated vesicles from the Golgi to the forming phagosome. As the majority of macrophage PKC-ε is cytosolic, and PKCs translocate from the cytosol to their sites of activity, it predicted that cytosolic PKC-ε concentrated at phagosomes to facilitate membrane addition (PMID: 34622926). Two PKC isozymes of the novel group, PKCε and PKCδ, have different and sometimes opposite effects. PKCε stimulates cell growth and differentiation while PKCδ is apoptotic (PMID: 21810427). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14976 Product name: Recombinant human PRKCE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 294-413 aa of BC109033 Sequence: VDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKV Predict reactive species Full Name: protein kinase C, epsilon Calculated Molecular Weight: 737 aa, 84 kDa Observed Molecular Weight: 84 kDa GenBank Accession Number: BC109033 Gene Symbol: PKC Epsilon Gene ID (NCBI): 5581 RRID: AB_10697812 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02156 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.