Iright
BRAND / VENDOR: Proteintech

Proteintech, 20881-1-AP, Synaptotagmin-10 Polyclonal antibody

CATALOG NUMBER: 20881-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Synaptotagmin-10 (20881-1-AP) by Proteintech is a Polyclonal antibody targeting Synaptotagmin-10 in WB, ELISA applications with reactivity to human, mouse, rat samples 20881-1-AP targets Synaptotagmin-10 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). SYT10 (synaptotagmin-10) functions as a Ca2+ sensor to trigger IGF-1 exocytosis in neurons. Loss of Syt10 impairs activity-dependent IGF-1 secretion in olfactory bulb neurons and results in smaller neurons and an overall reduction in the number of synapses (PMID: 21496647). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15018 Product name: Recombinant human SYT10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC101024 Sequence: MSFHKEDGVNSLCQKALHIVTELCFAGQVEWEKCSGIFPRDRGSQGGSSTDIS Predict reactive species Full Name: synaptotagmin X Calculated Molecular Weight: 523 aa, 59 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC101024 Gene Symbol: Synaptotagmin-10 Gene ID (NCBI): 341359 RRID: AB_3669351 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6XYQ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924