Proteintech, 20889-1-AP, SLC16A4 Polyclonal antibody

Size: 20ul / 150ul The SLC16A4 (20889-1-AP) by Proteintech is a Polyclonal antibody targeting SLC16A4 in WB, IHC, ELISA applications with reactivity to human samples 20889-1-AP targets SLC16A4 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells, HeLa cells, MCF-7 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC16A4, also named as MCT5, is a proton-linked monocarboxylate transporter which can catalyze the rapid transport across the plasma membrane of many monocarboxylates. It has been reported that SLC16A4 is expressed in human intestine, liver and kidney. (PMID:18996437) Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14190 Product name: Recombinant human SLC16A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC021664 Sequence: MLKREGKVQPYTKTLDGGWGWMIVIHFFLVNVFVMGMTKTFAIFFVVFQEEFEGTSEQIGWIGSIMSSLR Predict reactive species Full Name: solute carrier family 16, member 4 (monocarboxylic acid transporter 5) Calculated Molecular Weight: 487 aa, 54 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC021664 Gene Symbol: SLC16A4 Gene ID (NCBI): 9122 RRID: AB_2878757 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15374 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.