Proteintech, 20892-1-AP, SEC23IP Polyclonal antibody

Size: 20ul / 150ul The SEC23IP (20892-1-AP) by Proteintech is a Polyclonal antibody targeting SEC23IP in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 20892-1-AP targets SEC23IP in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse kidney tissue, HeLa cells, U-251 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SEC23-interacting protein (SEC23IP), also known as p125, is a member of the phosphatidic acid preferring-phospholipase A1 family. SEC23IP interacts with Sec23, a coat component of COPII vesicles which are involved in protein export from the endoplasmic reticulum (ER). SEC23IP localizes to ER exit sites and participates in the organization of this compartment (PMID: 15623529). It may have a role in the early stage of the secretory pathway (PMID: 10400679). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14916 Product name: Recombinant human SEC23IP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 651-1000 aa of BC063800 Sequence: ETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEMGIPLGPRKKIANFVEHKAAKLKKAASEKKAVAATSTKGQEQSAQKTKDMASLPSESNEPKRKLPVGACVSSVCVNYESFEVGAGQVSVAYNSLDFEPEIFFALGSPIAMFLTIRGVDRIDENYSLPTCKGFFNIYHPLDPVAYRLEPMIVPDLDLKAVLIPHHKGRKRLHLELKESLSRMGSDLKQGFISSLKSAWQTLNEFARAHTSSTQLQEELEKVANQIKEEEEKQVVEAEKVVESPDFSKDEDYLGKVGMLNGGRRIDYVLQEKPIESFNEYLFALQSHLCYWESEDTALLLLKEIYRTMNISPEQPQH Predict reactive species Full Name: SEC23 interacting protein Calculated Molecular Weight: 1000 aa, 111 kDa Observed Molecular Weight: 125 kDa GenBank Accession Number: BC063800 Gene Symbol: SEC23IP Gene ID (NCBI): 11196 RRID: AB_10896458 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6Y8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.