Proteintech, 20904-1-AP, FAM71E2 Polyclonal antibody

Size: 20ul / 150ul The FAM71E2 (20904-1-AP) by Proteintech is a Polyclonal antibody targeting FAM71E2 in WB, IHC, ELISA applications with reactivity to human samples 20904-1-AP targets FAM71E2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue, HepG2 cells Positive IHC detected in: human brain tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15027 Product name: Recombinant human FAM71E2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 74-197 aa of BC031875 Sequence: SLPGLVLPDILLIGQPAEDRDCSGLVLTRMIPLDLVHLCVHDLSAWRLKLRLVSGRQYYLALDAPDNEVGFLFHCWVRLINLLQEPAPTWTPRTTRTAPLDMPLAKAPASTWHLQDQPISRHAV Predict reactive species Full Name: family with sequence similarity 71, member E2 Calculated Molecular Weight: 302 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC031875 Gene Symbol: FAM71E2 Gene ID (NCBI): 284418 RRID: AB_11183765 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N5Q1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.