Proteintech, 20918-1-AP, LRRC17 Polyclonal antibody

Size: 20ul / 150ul The LRRC17 (20918-1-AP) by Proteintech is a Polyclonal antibody targeting LRRC17 in WB, ELISA applications with reactivity to human, mouse, rat samples 20918-1-AP targets LRRC17 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse heart tissue, rat bone marrow tissue, rat spleen tissue, rat thymus tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information Leucine-rich repeat-containing protein 17 (LRRC17) is an LRR protein predominantly expressed by osteoblasts. LRRC17 acts as a negative regulator of receptor activator of NF-kappaB ligand (RANKL)-induced osteoclast differentiation (PMID: 19336404). It has been reported that low plasma level of LRRC17 is an independent risk factor for osteoporotic fractures (PMID: 27355564). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15117 Product name: Recombinant human LRRC17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-441 aa of BC027903 Sequence: KIRTLKNNMFSKFKKLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKPEVDSTFCHNYVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHELKKLNLSSNGIEFIDPAAFLGLTHLEELDLSNNSLQNFDYGVLEDLYFLKLLWLRDNPWRCDYNIHYLYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDEWEKKHRDHTAKKQSVIITIVG Predict reactive species Full Name: leucine rich repeat containing 17 Calculated Molecular Weight: 441 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC027903 Gene Symbol: LRRC17 Gene ID (NCBI): 10234 RRID: AB_2878763 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q8N6Y2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.