Iright
BRAND / VENDOR: Proteintech

Proteintech, 20921-1-AP, PTAFR Polyclonal antibody

CATALOG NUMBER: 20921-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PTAFR (20921-1-AP) by Proteintech is a Polyclonal antibody targeting PTAFR in IHC, ELISA applications with reactivity to human samples 20921-1-AP targets PTAFR in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human lung tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15128 Product name: Recombinant human PTAFR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 245-342 aa of BC013816 Sequence: FVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKFRKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN Predict reactive species Full Name: platelet-activating factor receptor Calculated Molecular Weight: 342 aa, 39 kDa GenBank Accession Number: BC013816 Gene Symbol: PTAFR Gene ID (NCBI): 5724 RRID: AB_2878766 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25105 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924