Proteintech, 20936-1-AP, DPCD Polyclonal antibody

Size: 20ul / 150ul The DPCD (20936-1-AP) by Proteintech is a Polyclonal antibody targeting DPCD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20936-1-AP targets DPCD in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, human testis tissue, rat testis tissue Positive IHC detected in: mouse testis tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DPCD (for deleted in a mouse model of primary ciliary dyskinesia), is predicted to code for a protein of 23 kDa which remains a novel candidate gene for PCD (Primary ciliary dyskinesia). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15029 Product name: Recombinant human RP11-529I10.4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-203 aa of BC031695 Sequence: MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKFSIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCKTQ Predict reactive species Full Name: deleted in a mouse model of primary ciliary dyskinesia Calculated Molecular Weight: 203 aa, 23 kDa Observed Molecular Weight: 23-26 kDa GenBank Accession Number: BC031695 Gene Symbol: DPCD Gene ID (NCBI): 25911 RRID: AB_10734461 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BVM2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.