Proteintech, 20943-1-AP, SAP30BP Polyclonal antibody

Size: 20ul / 150ul The SAP30BP (20943-1-AP) by Proteintech is a Polyclonal antibody targeting SAP30BP in WB, ELISA applications with reactivity to human, mouse samples 20943-1-AP targets SAP30BP in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information SAP30BP, also named as SAP30-binding protein, is a 308 amino acid protein, which belongs to the HCNGP family. SAP30BP localizes in Nucleus and Interacts with SAP30. DDX54 Induces cell death and may act as a transcriptional corepressor of a gene related to cell survival. SAP30BP may be involved in the regulation of beta-2-microglobulin genes. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15051 Product name: Recombinant human SAP30BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-308 aa of BC007592 Sequence: MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ Predict reactive species Full Name: SAP30 binding protein Calculated Molecular Weight: 308 aa, 34 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC007592 Gene Symbol: SAP30BP Gene ID (NCBI): 29115 RRID: AB_2878770 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHR5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.