Iright
BRAND / VENDOR: Proteintech

Proteintech, 20945-1-AP, KIAA1984 Polyclonal antibody

CATALOG NUMBER: 20945-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KIAA1984 (20945-1-AP) by Proteintech is a Polyclonal antibody targeting KIAA1984 in WB, IF/ICC, ELISA applications with reactivity to human samples 20945-1-AP targets KIAA1984 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15053 Product name: Recombinant human KIAA1984 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 426-495 aa of BC007542 Sequence: QREVVLSNTLDLNSKLAYCEGKLTYLADRVQMVSRTEEGDTKVRDTLESSTLMEKYNTRISFENREEDMI Predict reactive species Full Name: KIAA1984 Calculated Molecular Weight: 534 aa, 63 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC007542 Gene Symbol: KIAA1984 Gene ID (NCBI): 84960 RRID: AB_2878772 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T5S1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924