Iright
BRAND / VENDOR: Proteintech

Proteintech, 20949-1-AP, FBXL20 Polyclonal antibody

CATALOG NUMBER: 20949-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FBXL20 (20949-1-AP) by Proteintech is a Polyclonal antibody targeting FBXL20 in WB, IF/ICC, ELISA applications with reactivity to human samples 20949-1-AP targets FBXL20 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FBXL20 (F-box and leucine-rich repeat protein 20) is a member of the F-box protein family, which plays a crucial role in the ubiquitin-proteasome system. FBXL20 acts as a substrate recognition component of the SCF (Skp1-Cul1-F-box) ubiquitin ligase complex, targeting specific proteins for ubiquitination and subsequent degradation. This protein is involved in cell cycle regulation, signal transduction, and maintenance of protein homeostasis. Abnormal expression of FBXL20 has been implicated in various diseases, including cancer and neurodegenerative disorders. Research also suggests that FBXL20 may regulate the degradation of 4-1BB, an important immune stimulator, through ubiquitination. (PMID: 25593308, PMID: 27502938, PMID: 35112462) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15071 Product name: Recombinant human FBXL20 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 80-436 aa of BC007557 Sequence: RVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPPSVGGSRQRFCRCCIIL Predict reactive species Full Name: F-box and leucine-rich repeat protein 20 Calculated Molecular Weight: 436 aa, 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC007557 Gene Symbol: FBXL20 Gene ID (NCBI): 84961 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96IG2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924