Proteintech, 21012-1-AP, C9orf117 Polyclonal antibody

Size: 20ul / 150ul The C9orf117 (21012-1-AP) by Proteintech is a Polyclonal antibody targeting C9orf117 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 21012-1-AP targets C9orf117 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, Raji cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information C9orf117 (Cilia- and flagella-associated protein 157, CFAP157) protein localizes to basal bodies and interacts with tubulin and the centrosomal protein CEP350 (PMID: 27965440). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15234 Product name: Recombinant human C9orf117 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC141809 Sequence: MAPKKSVSKAGKELEVKKKGGKKEPVVAVEPPLAKEMKEFYHIQIRDLEDRLARYQRKWDELAVQEKMFRQEFEQLANNKKEIVAFLKRTLNQQVDEITDLNEQLQNLQLAKEMEKDAFEAQLAQVRHEFQETKDQLTTENIILGGKLAALEEFRLQKEEVTDKFTLLEEQVRKQENEFRDYAYNLEKKSVLDKDRLRKEIIQRVNLVANEFHKVTTNRMWETTKRAIKENNGITLQMARVSQQGMKLLQENEQLKGRQNNLCKQLELLENTQKVMARHKRGHQKIILMLTKKCQEQQQDTKEAEELRLLLSQLEQRSLQLQVDNQALKSQRDQLSLQLEQQQVDLQRLQ Predict reactive species Full Name: chromosome 9 open reading frame 117 Calculated Molecular Weight: 520 aa, 61 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC141809 Gene Symbol: C9orf117 Gene ID (NCBI): 286207 RRID: AB_3669353 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5JU67 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.