Proteintech, 21032-1-AP, FSD1L Polyclonal antibody

Size: 20ul / 150ul The FSD1L (21032-1-AP) by Proteintech is a Polyclonal antibody targeting FSD1L in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 21032-1-AP targets FSD1L in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HEK-293 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15345 Product name: Recombinant human FSD1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 418-530 aa of BC036746 Sequence: TSWCIHVNNWLQNTFAAKHNNKVKALDVTVPEKIGVFCDFDGGQLSFYDANSKQLLYSFKTKFTQPVLPGFMVWCGGLSLSTGMQVPSAVRTLQKSENGMTGSASSLNNVVTQ Predict reactive species Full Name: fibronectin type III and SPRY domain containing 1-like Calculated Molecular Weight: 530 aa, 60 kDa Observed Molecular Weight: 56-65 kDa GenBank Accession Number: BC036746 Gene Symbol: FSD1L Gene ID (NCBI): 83856 RRID: AB_10732808 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXM9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.