Iright
BRAND / VENDOR: Proteintech

Proteintech, 21050-1-AP, EPCAM/CD326 Polyclonal antibody

CATALOG NUMBER: 21050-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EPCAM/CD326 (21050-1-AP) by Proteintech is a Polyclonal antibody targeting EPCAM/CD326 in WB, IHC, IF/ICC, IF-P, IF-Fro, FC, ELISA applications with reactivity to human, mouse, rat samples 21050-1-AP targets EPCAM/CD326 in WB, IHC, IF/ICC, IF-P, IF-Fro, FC, IP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, mouse colon tissue, rat colon tissue Positive IHC detected in: human colon cancer tissue, mouse colon tissue, human breast cancer tissue, human colon tissue, mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse colon tissue, MCF-7 cells, mouse lung tissue Positive IF-Fro detected in: mouse colon tissue Positive IF/ICC detected in: HT-29 cells, MCF-7 cells Positive FC detected in: HT-29 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:500-1:2000 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC): FC : 0.50 ug per 10^6 cells in a 100 µl suspension Background Information Epithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15393 Product name: Recombinant human EPCAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-264 aa of BC014785 Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGL Predict reactive species Full Name: epithelial cell adhesion molecule Calculated Molecular Weight: 314 aa, 35 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC014785 Gene Symbol: EPCAM Gene ID (NCBI): 4072 RRID: AB_10693684 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P16422 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924