Proteintech, 21060-1-AP, C19orf45 Polyclonal antibody

Size: 20ul / 150ul The C19orf45 (21060-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf45 in IHC, ELISA applications with reactivity to human samples 21060-1-AP targets C19orf45 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14887 Product name: Recombinant human C19orf45 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 142-491 aa of BC029824 Sequence: SLPPGDRDKLRIPPTTHQALFPPHDARPQPRAPSCHLGGPNTLKWDYTRQDGTSYQRQFQALPGPPALRCKRASSGVELGDCKISYGSTCSEQKQAYRPQDLPEDRYDKAQATAHIHCVNIRPGDGLFRDRTTKAEHFYAREPEPFVLHHDQTPESHILKGNWCPGPGSLDTFMQYFYGQPPPPTQPPSRHVPHEKLQSHVTLGEPKLLKRFFKTTMGSDYCPSEWRQVQKAPNLHLQQSYLPRGTGEFDFLTMNQKMLKPHRTPPAPVTEEMLQRCKYSHMEPPLGGLRFFSTQYKDEFPFKYQGPAALRLKNPQEGFVPLGTPHQRGCREKIDPLVPQPPMYLCPSQQ Predict reactive species Full Name: chromosome 19 open reading frame 45 Calculated Molecular Weight: 505 aa, 57 kDa GenBank Accession Number: BC029824 Gene Symbol: C19orf45 Gene ID (NCBI): 374877 RRID: AB_3085635 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NA69 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.