Iright
BRAND / VENDOR: Proteintech

Proteintech, 21070-1-AP, ELOF1 Polyclonal antibody

CATALOG NUMBER: 21070-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ELOF1 (21070-1-AP) by Proteintech is a Polyclonal antibody targeting ELOF1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21070-1-AP targets ELOF1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, HEK-293 cells, rat testis tissue Positive IF/ICC detected in: A549 cells, SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ELOF1 (elongation factor 1 homologue) is a small (83 aa), evolutionarily conserved, RNAPII-associated transcription elongation factor that is also a core component of the transcription-coupled DNA repair machinery with an additional role in preventing DNA damage during DNA replication (PMID: 34108663). Loss of ELOF1 strongly compromises AID-mediated deamination, SHM, and CSR, and that this is accompanied by a decrease in parameters of RNAPII pausing/stalling and in RNAPII RNA synthesis without a decrease in levels of S2P-RNAPII (PMID: 39386505). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15213 Product name: Recombinant human ELOF1 protein Source: e coli. -derived, PKG Tag: GST Domain: 1-83 aa of BC007516 Sequence: MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ Predict reactive species Full Name: elongation factor 1 homolog (S. cerevisiae) Calculated Molecular Weight: 9.5 kDa Observed Molecular Weight: 9 kDa GenBank Accession Number: BC007516 Gene Symbol: ELOF1 Gene ID (NCBI): 84337 RRID: AB_10693632 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P60002 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924