Proteintech, 21072-1-AP, MEKK3 Polyclonal antibody

Size: 20ul / 150ul The MEKK3 (21072-1-AP) by Proteintech is a Polyclonal antibody targeting MEKK3 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 21072-1-AP targets MEKK3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The mitogen-activated protein/ERK kinase kinase 3 (MEKK3) is a member of a family of MEKK/Ste11 serine/threonine protein kinases. One function of MEKK3 is to serve as an upstream regulatory kinase in the mitogen-activated protein kinase cascade, however, it also plays a critical role in other signaling pathways. MEKK3 regulates several important functions including cell survival and proliferation. It is ubiquitously expressed in multiple tissues and has been found in complexes with scaffold proteins and other kinases. (PMID: 18206350).Cerebral cavernous malformations (CCMs) complex regulation of MEKK3 is essential during vertebrate heart development. MEKK3 signalling and KLF2/4 may be targeted to develop new CCM therapeutics. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15223 Product name: Recombinant human MAP3K3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-366 aa of BC090859 Sequence: VSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGK Predict reactive species Full Name: mitogen-activated protein kinase kinase kinase 3 Calculated Molecular Weight: 657 aa, 74 kDa Observed Molecular Weight: 71 kDa, 74 kDa GenBank Accession Number: BC090859 Gene Symbol: MEKK3 Gene ID (NCBI): 4215 RRID: AB_2878806 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99759 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.