Iright
BRAND / VENDOR: Proteintech

Proteintech, 21075-1-AP, ZNF703 Polyclonal antibody

CATALOG NUMBER: 21075-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF703 (21075-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF703 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21075-1-AP targets ZNF703 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, human brain tissue, mouse spleen tissue Positive IHC detected in: human breast cancer tissue, human malignant melanoma tissue, mouse cerebellum tissue, mouse intestine, mouse skin tissue, rat cerebellum tissue, rat skin tissue, rat small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15242 Product name: Recombinant human ZNF703 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 241-590 aa of BC032534 Sequence: ELDKKDQEPKPSPEPAAVSRGGGGEPGAHGGAESGASGRKSEPPSALVGAGHVAPVSPYKPGHSVFPLPPSSIGYHGSIVGAYAGYPSQFVPGLDPSKSGLVGGQLSGGLGLPPGKPPSSSPLTGASPPSFLQGLCRDPYCLGGYHGASHLGGSSCSTCSAHDPAGPSLKAGGYPLVYPGHPLQPAALSSSAAQAALPGHPLYTYGFMLQNEPLPHSCNWVAASGPCDKRFATSEELLSHLRTHTALPGAEKLLAAYPGASGLGSAAAAAAAAASCHLHLPPPAAPGSPGSLSLRNPHTLGLSRYHPYGKSHLSTAGGLAVPSLPTAGPYYSPYALYGQRLASASALGYQ Predict reactive species Full Name: zinc finger protein 703 Calculated Molecular Weight: 590 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC032534 Gene Symbol: ZNF703 Gene ID (NCBI): 80139 RRID: AB_10732687 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H7S9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924