Proteintech, 21079-1-AP, FAM119A Polyclonal antibody

Size: 20ul / 150ul The FAM119A (21079-1-AP) by Proteintech is a Polyclonal antibody targeting FAM119A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21079-1-AP targets FAM119A in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, L02 cells, THP-1 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15282 Product name: Recombinant human FAM119A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-218 aa of BC033720 Sequence: ITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLILGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQKRNQKEDL Predict reactive species Full Name: family with sequence similarity 119, member A Calculated Molecular Weight: 218 aa, 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC033720 Gene Symbol: FAM119A Gene ID (NCBI): 151194 RRID: AB_10755289 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WXB1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.