Iright
BRAND / VENDOR: Proteintech

Proteintech, 21083-1-AP, ZNF485 Polyclonal antibody

CATALOG NUMBER: 21083-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF485 (21083-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF485 in IF/ICC, ELISA applications with reactivity to human samples 21083-1-AP targets ZNF485 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HEK-293 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15297 Product name: Recombinant human ZNF485 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 53-402 aa of BC014161 Sequence: MSALKQSTSEASVLGERTKSVMMEKGLDWEGRSSTEKNYKCKECGKVFKYNSSFISHQRNHTSEKPHKCKECGIAFMNSSSLLNHHKVHAGKQPYRCIECGKFLKKHSTFINHQRIHSREKPHKCIECGKTFRKNSILLSHQRIHTGQKPYKCNDCGKAFAQNAALTRHERIHSGEKPFKCNKCGRAFRDNSTVLEHQKIHTGEKPYQCNECGKAFRKSSTLISHQRMHTGEKPYHCSKCGKSFRYSSSFAGHQKTHSGNKPYQCRDCGKAFTKSSTLTGHQRIHTGEKPYHCKKCGKAFRHSSGLVEHQRLHTGEKPYKCNECGKAFPRSSALKQHKKIHNKERAMKCS Predict reactive species Full Name: zinc finger protein 485 Calculated Molecular Weight: 441 aa, 50 kDa GenBank Accession Number: BC014161 Gene Symbol: ZNF485 Gene ID (NCBI): 220992 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NCK3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924