Iright
BRAND / VENDOR: Proteintech

Proteintech, 21100-1-AP, ANKRD13D Polyclonal antibody

CATALOG NUMBER: 21100-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ANKRD13D (21100-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD13D in WB, IHC, ELISA applications with reactivity to human samples 21100-1-AP targets ANKRD13D in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HT-1080 cells Positive IHC detected in: human small intestine tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information ANKRD13D, also named as Ankyrin repeat domain-containing protein 13D, is a 518 amino acid protein, which contains 4 UIM (ubiquitin-interacting motif) repeats. ANKRD13D localizes in the cell membrane and late endosome. ANKRD13D as a ubiquitin-binding protein that specifically recognizes and binds 'Lys-63'-linked ubiquitin. The calculated molecular weight of ANKRD13D is 58kDa, but we decteted a 50kDa protein via western blot. experiment. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15369 Product name: Recombinant human ANKRD13D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 284-367 aa of BC110419 Sequence: LSDQDKSRSKAGKTPFQSFLGMAQQHSSHTGAPVQQAASPTNPTAISPEEYFDPNFSLESRNIGRPIEMSSKVQRFKATLWLSE Predict reactive species Full Name: ankyrin repeat domain 13 family, member D Calculated Molecular Weight: 605 aa, 68 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC110419 Gene Symbol: ANKRD13D Gene ID (NCBI): 338692 RRID: AB_2878813 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZTN6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924