Iright
BRAND / VENDOR: Proteintech

Proteintech, 21106-1-AP, Collagen Type XXVI Polyclonal antibody

CATALOG NUMBER: 21106-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Collagen Type XXVI (21106-1-AP) by Proteintech is a Polyclonal antibody targeting Collagen Type XXVI in IHC, IF/ICC, ELISA applications with reactivity to human samples 21106-1-AP targets Collagen Type XXVI in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information COL26A1(Collagen alpha-1(XXVI) chain), also known as EMID2. It is expected to be located in the cytoplasm and extracellular space. COL26A1 is expressed in many tissues, especially in brain tissues, including cerebral cortex, cerebellum and basal ganglia. In the single cell type, the expression of COL26A1 is mainly concentrated in excitatory and inhibitory neurons. The protein is a new member of the collagen family. Its function has not been fully demonstrated in thyroid cancer (THCA), but it is known that collagen can promote cancer progression. COL26A1 may be involved in immune-related pathways, such as CTLA4 pathway, IL-10 signaling pathway and chemokine receptor binding chemokine. The molecular weight of COL26A1 is 45 kDa. COL26A1 is significantly up-regulated in thyroid carcinoma, and its high expression is related to poor prognosis. It is also significantly related to tumor microenvironment, which may involve immune-related pathways in the process of tumor occurrence(PMID: 38197076). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15382 Product name: Recombinant human EMID2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-247 aa of BC110393 Sequence: GFTGSNCDEECMNCTRLSDMSERLTTLEAKVLLLEAAERPSSPDNDLPAPESTPPTWNEDFLPDAIPLAHPVPRQRRPTGPAGPPGQTGPPGPAGPPGSKGDRGQTGEKGPAGPPGLLGPPGPRGLPGEM Predict reactive species Full Name: EMI domain containing 2 Calculated Molecular Weight: 441 aa, 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC110393 Gene Symbol: EMID2 Gene ID (NCBI): 136227 RRID: AB_3669359 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96A83 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924