Proteintech, 21155-1-AP, SPINK7 Polyclonal antibody

Size: 20ul / 150ul The SPINK7 (21155-1-AP) by Proteintech is a Polyclonal antibody targeting SPINK7 in IHC, ELISA applications with reactivity to human samples 21155-1-AP targets SPINK7 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SPINK7, also named esophageal cancer-related gene 2 (ECRG 2), is a member of the SPINK protease inhibitor family. It is thought to function as a tumor suppressor gene regulating the protease cascades during carcinogenesis and invasion of esophageal cancer by regulation of migration through urokinase-type plasmin activator/plasmin MAP kinase pathway. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15727 Product name: Recombinant human SPINK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC109385 Sequence: MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC Predict reactive species Full Name: serine peptidase inhibitor, Kazal type 7 (putative) Calculated Molecular Weight: 85 aa, 9 kDa GenBank Accession Number: BC109385 Gene Symbol: SPINK7 Gene ID (NCBI): 84651 RRID: AB_3085640 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P58062 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.