Iright
BRAND / VENDOR: Proteintech

Proteintech, 21173-1-AP, MYLK2 Polyclonal antibody

CATALOG NUMBER: 21173-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MYLK2 (21173-1-AP) by Proteintech is a Polyclonal antibody targeting MYLK2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21173-1-AP targets MYLK2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, human skeletal muscle tissue, Jurkat cells, A549 cells, rat skeletal muscle tissue Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MYLK2, also named as MLCK2, belongs to the protein kinase superfamily and CAMK Ser/Thr protein kinase family. MYLK2 catalyze the reaction: ATP + [myosin light-chain] = ADP + [myosin light-chain] phosphate. MYLK2 is implicated in the level of global muscle contraction and cardiac function. MYLK2 phosphorylates a specific serine in the N-terminus of a myosin light chain. Mutation of MYLK2 will cause the cardiomyopathy familial hypertrophic (CMH). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15424 Product name: Recombinant human MYLK2 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-300 aa of BC069627 Sequence: MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASEKGDGTLAQPSTSSQGPKGEGDRGGGPAEGSAGPPAALPQQTATPETSVKKPKAEQGASGSQDPGKPRVGKKAAEGQAAARRGSPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEVGQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVC Predict reactive species Full Name: myosin light chain kinase 2 Calculated Molecular Weight: 596 aa, 65 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC069627 Gene Symbol: MYLK2 Gene ID (NCBI): 85366 RRID: AB_10733123 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H1R3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924