Proteintech, 21176-1-AP, PDP1 Polyclonal antibody

Size: 20ul / 150ul The PDP1 (21176-1-AP) by Proteintech is a Polyclonal antibody targeting PDP1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 21176-1-AP targets PDP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-3 cells, mouse brain tissue, mouse skeletal muscle tissue, mouse heart tissue, mouse liver tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human prostate cancer tissue, human thyroid cancer tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Pyruvate dehydrogenase phosphatase 1 (PDP1) is a key hormone-regulated metabolic enzyme that dephosphorylates and activates pyruvate dehydrogenase (PDH), thereby stimulating the conversion of pyruvate into acetyl-CoA (PMID: 36453802). PDP1 expression is regulated by FLT3-ITD in a context-dependent manner, and that it is centrally involved in the adaptation of AML glucose metabolism to the requirements of proliferation, survival and the therapeutic response to FLT3 inhibition (PMID: 37935978). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15453 Product name: Recombinant human PPM2C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC047619 Sequence: MPAPTQLFFPLIRNCELSRIYGTACYCHHKHLCCSSSYIPQSRLRYTPHPAYATFCRPKENWWQYTQGRRYASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQA Predict reactive species Full Name: protein phosphatase 2C, magnesium-dependent, catalytic subunit Calculated Molecular Weight: 537 aa, 61 kDa Observed Molecular Weight: 55-61 kDa GenBank Accession Number: BC047619 Gene Symbol: PDP1 Gene ID (NCBI): 54704 RRID: AB_2878824 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P0J1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.