Proteintech, 21183-1-AP, C13orf18 Polyclonal antibody

Size: 20ul / 150ul The C13orf18 (21183-1-AP) by Proteintech is a Polyclonal antibody targeting C13orf18 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 21183-1-AP targets C13orf18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human skeletal muscle tissue, MCF-7 cells Positive IHC detected in: human testis tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15474 Product name: Recombinant human C13orf18 protein Source: e coli. -derived, PKG Tag: GST Domain: 1-306 aa of BC032311 Sequence: MVSQSTVRQDSPVEPWEGISDHSGIIDGSPRLLNTDHPPCQLDIRLMRHKAVWINPQDVQQQPQDLQSQVPAAGNSGTHFVTDAASPSGPSPSCLGDSLAETTLSEDTTDSVGSASPHGSSEKSSSFSLSSTEVHMVRPGYSHRVSLPTSPGILATSPYPETDSAFFEPSHLTSAADEGAVQVSRRTISSNSFSPEVFVLPVDVEKENAHFYVADMIISAMEKMKCNILSQQQTESWSKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSPVTETRTYHDVKEICKCDVDEFV Predict reactive species Full Name: chromosome 13 open reading frame 18 Calculated Molecular Weight: 662 aa, 73 kDa Observed Molecular Weight: 66 kDa GenBank Accession Number: BC032311 Gene Symbol: C13orf18 Gene ID (NCBI): 80183 RRID: AB_10733098 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H714 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.