Iright
BRAND / VENDOR: Proteintech

Proteintech, 21206-1-AP, HSPA4 Polyclonal antibody

CATALOG NUMBER: 21206-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSPA4 (21206-1-AP) by Proteintech is a Polyclonal antibody targeting HSPA4 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat, monkey samples 21206-1-AP targets HSPA4 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: C6 cells, HEK-293 cells, mouse testis tissue, NIH/3T3 cells, mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human colon cancer tissue, human breast cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, HepG2 cells Positive FC (Intra) detected in: C6 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information HSPA4 (also known as Apg-2, HSP70RY) is a 110 kDa cytosolic protein, a member of the heat-shock protein 110 (HSP110) subfamily of HSP70 proteins which are highly conserved chaperons implicated in protein folding, protein refolding, protein transport, and protein targeting. HSPA4 is ubiquitously expressed and its expression is not heat inducible. Overexpression of HSPA4 has been reported in some leukemia and solid tumors. This antibody well recognized the endogenous HSPA4 protein in mouse brain/ testis tissues. (PMID: 21487003) Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15581 Product name: Recombinant human HSPA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 680-840 aa of BC110861 Sequence: NLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID Predict reactive species Full Name: heat shock 70kDa protein 4 Calculated Molecular Weight: 840 aa, 94 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC110861 Gene Symbol: HSPA4 Gene ID (NCBI): 3308 RRID: AB_10733641 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P34932 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924