Proteintech, 21212-1-AP, SFRS2 Polyclonal antibody

Size: 20ul / 150ul The SFRS2 (21212-1-AP) by Proteintech is a Polyclonal antibody targeting SFRS2 in WB, ELISA applications with reactivity to human samples 21212-1-AP targets SFRS2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SFRS2, also named as PR264 and SC-35, belongs to the splicing factor SR family. SFRS2 is necessary for the splicing of pre-mRNA. It is required for formation of the earliest ATP-dependent splicing complex and interacts with spliceosomal components bound to both the 5'- and 3'-splice sites during spliceosome assembly. It also is required for ATP-dependent interactions of both U1 and U2 snRNPs with pre-mRNA. It binds to purine-rich RNA sequences, either 5'-AGSAGAGTA-3' (S=C or G) or 5'-GTTCGAGTA-3'. SFRS2 can bind to beta-globin mRNA and commit it to the splicing pathway. The antibody has no cross reaction to SFRS2B. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15612 Product name: Recombinant human SFRS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC070086 Sequence: MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRY Predict reactive species Full Name: splicing factor, arginine/serine-rich 2 Calculated Molecular Weight: 221 aa, 25 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC070086 Gene Symbol: SFRS2 Gene ID (NCBI): 6427 RRID: AB_3085645 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01130 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.