Proteintech, 21217-1-AP, ADAD2 Polyclonal antibody

Size: 20ul / 150ul The ADAD2 (21217-1-AP) by Proteintech is a Polyclonal antibody targeting ADAD2 in IHC, ELISA applications with reactivity to human, mouse, rat samples 21217-1-AP targets ADAD2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15650 Product name: Recombinant human ADAD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 244-583 aa of BC033491 Sequence: REIPRARGHVKEIYKLVALGTGSSCCAGWLEFSGQQLHDCHGLVIARRALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPPFTLKPRVFLHLYISNTPKGAARDIYLPPTSEGGLPHSPPMRLQAHVLGQLKPVCYVAPSLCDTHVGCLSASDKLARWAVLGLGGALLAHLVSPLYSTSLILADSCHDPPTLSRAIHTRPCLDSVLGPCLPPPYVRTALHLFAGPPVAPSEPTPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAFHQAARAVGKPYLLALKTYEAAKAGPYQEARRQLSLLLDQQGLGAWPSKPLVGKFRN Predict reactive species Full Name: adenosine deaminase domain containing 2 Calculated Molecular Weight: 665 aa, 71 kDa Observed Molecular Weight: 62-71 kDa GenBank Accession Number: BC033491 Gene Symbol: ADAD2 Gene ID (NCBI): 161931 RRID: AB_10732691 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NCV1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.