Proteintech, 21226-1-AP, TRHDE Polyclonal antibody

Size: 20ul / 150ul The TRHDE (21226-1-AP) by Proteintech is a Polyclonal antibody targeting TRHDE in WB, ELISA applications with reactivity to human, mouse, rat samples 21226-1-AP targets TRHDE in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Thyrotropin-releasing hormone-degrading ectoenzyme (TRHDE) belongs to the peptidase M1 family. TRHDE expression is detected at relatively late phases of brain development. TRHDE functions to inactivate thyrotropin-releasing hormone (PMID: 30518145, PMID: 32457627). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15681 Product name: Recombinant human TRHDE protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 675-1024 aa of BC150181 Sequence: KGSWLLGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAGLIDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNEYILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDWISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNLLNRLLNLSLNSEVVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSKLISGVTEFLNTEGELKELKNFMKNYDGVAAASFSRAVETVEANVRWKMLYQDELFQWLGKALRH Predict reactive species Full Name: thyrotropin-releasing hormone degrading enzyme Calculated Molecular Weight: 1024 aa, 117 kDa Observed Molecular Weight: 122 kDa GenBank Accession Number: BC150181 Gene Symbol: TRHDE Gene ID (NCBI): 29953 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKU6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.