Iright
BRAND / VENDOR: Proteintech

Proteintech, 21248-1-AP, OSTbeta / SLC51B Polyclonal antibody

CATALOG NUMBER: 21248-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OSTbeta / SLC51B (21248-1-AP) by Proteintech is a Polyclonal antibody targeting OSTbeta / SLC51B in IHC, ELISA applications with reactivity to human samples 21248-1-AP targets OSTbeta / SLC51B in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Organic solute transporter alpha-beta (Ostα-Ostβ) is a heteromeric transporter that has been localized to the basolateral membrane of epithelial cells of the small intestine, kidney and liver, and appears to be essential for bile acid homeostasis. The transporter is composed of a predicted 340-amino acid, 7-transmembrane domain protein (Ostα) and a putative 128-amino acid, single-transmembrane domain polypeptide (Ostβ). Ostα-Ostβ transports bile acids by a facilitated diffusion mechanism; therefore, Ostα-Ostβ can mediate cellular efflux or uptake depending on the substrate's electrochemical gradient. It's reported that Ostα-Ostβ is not only essential for bile acid, but also vital for sterol disposition and enterohepatic circulation(PMID: 21691099). Specification Tested Reactivity: human Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15751 Product name: Recombinant human OSTbeta protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC103842 Sequence: MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES Predict reactive species Full Name: organic solute transporter beta Calculated Molecular Weight: 128 aa, 14 kDa GenBank Accession Number: BC103842 Gene Symbol: SLC51B Gene ID (NCBI): 123264 RRID: AB_3085647 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86UW2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924