Iright
BRAND / VENDOR: Proteintech

Proteintech, 21274-1-AP, TMEM64 Polyclonal antibody

CATALOG NUMBER: 21274-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM64 (21274-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM64 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21274-1-AP targets TMEM64 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human prostate cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Tmem64 (transmembrane protein 64) is a positive modulator of osteoclast differentiation by SERCA2-dependent Ca2+ signaling (PMID: 23395171). Altered Levels of mRNAs for Calcium-Binding/Associated Proteins, Annexin A1, S100A4, and TMEM64 are associated with osteoporosis in peripheral blood mononuclear cells (PMID: 31814858). Tmem64 is involved in the metastatic progression of prostate cancer cells by regulating Wnt3a secretion (PMID: 31289498). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15753 Product name: Recombinant human TMEM64 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 301-380 aa of BC113828 Sequence: DVIAEQSVSGYFVFCLQIIISIGLMFYVVHRAQVELNAAIVACEMELKSSLVKGNQPNTSGSSFYNKRTLTFSGGGINVV Predict reactive species Full Name: transmembrane protein 64 Calculated Molecular Weight: 380 aa, 40 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC113828 Gene Symbol: TMEM64 Gene ID (NCBI): 169200 RRID: AB_3085648 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6YI46 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924