Proteintech, 21287-1-AP, SLC39A2 Polyclonal antibody

Size: 20ul / 150ul The SLC39A2 (21287-1-AP) by Proteintech is a Polyclonal antibody targeting SLC39A2 in WB, IHC, ELISA applications with reactivity to human samples 21287-1-AP targets SLC39A2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Positive IHC detected in: human colon cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC39A2 (hZIP2) is a human zinc importer in the ZIP family, which is essential in the maintenance of intracellular zinc homeostasis and is upregulated by zinc depletion. SLC39A2 is highly expressed in prostate epithelial cells and is involved in prostate cancer development. Most SLC39 proteins consist of eight transmembrane domains (TMDs), with extracellular or intravesicular amino and carboxy termini (PMID: 34790705). Zip2 gene knockout exacerbated myocardial I/R injury, whereas Zip2 gene transfer reduced myocardial infarction (PMID: 31095941). The predicted molecular weight of SLC39A2 is 33 kDa, and a band of dimers at 66 kDa can also be detected by this antibody (PMID: 24619115). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15807 Product name: Recombinant human SLC39A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 61-175 aa of BC096723 Sequence: FMHMTAEALEEIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFLVFFLESLALQCCPGAAGGSTVQDEEWGGAHIFELHSHGHLPSPSKGPLRALVLLLSLSFH Predict reactive species Full Name: solute carrier family 39 (zinc transporter), member 2 Calculated Molecular Weight: 309 aa, 33 kDa Observed Molecular Weight: 33 kDa, 66-70 kDa GenBank Accession Number: BC096723 Gene Symbol: SLC39A2 Gene ID (NCBI): 29986 RRID: AB_3085650 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NP94 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.