Iright
BRAND / VENDOR: Proteintech

Proteintech, 21290-1-AP, SMYD2 Polyclonal antibody

CATALOG NUMBER: 21290-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMYD2 (21290-1-AP) by Proteintech is a Polyclonal antibody targeting SMYD2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21290-1-AP targets SMYD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C2C12 cell, HEK-293 cells, C2C12 cells, U2OS cells, mouse heart tissue, rat heart tissue Positive IHC detected in: rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SMYD2, also known as SET and MYND domain containing 2, encodes an enzyme called N-lysine methyltransferase SMYD2, which plays a crucial role in cellular processes, including histone methylation, non-histone protein methylation, cell proliferation and differentiation, DNA repair (PMID: 18065756, PMID: 36191822). Aberrant SMYD2 expression has been linked to various cancers, including colon cancer, lung cancer, and cervical cancer. Smyd2 is strongly expressed in muscle cells with highest expression in the neonatal heart (PMID: 25125178). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15823 Product name: Recombinant human SMYD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-272 aa of BC098305 Sequence: MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDK Predict reactive species Full Name: SET and MYND domain containing 2 Calculated Molecular Weight: 433 aa, 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC098305 Gene Symbol: SMYD2 Gene ID (NCBI): 56950 RRID: AB_10733881 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRG4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924