Proteintech, 21298-1-AP, Kv4.2 Polyclonal antibody

Size: 20ul / 150ul The Kv4 21298-1-AP targets Kv4.2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, DU 145 cells, HeLa cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Voltage-gated potassium or Kv channels, specifically those mediating low threshold, rapidly inactivating Ito and IA currents, are known to regulate cardiac and neuronal membrane excitability, respectively (PMID: 12829703). Voltage-gated potassium channel subunit Kv4.2, encoded by the KCND2 gene, belongs to the potassium channel family and D (Shal) subfamily. It is a pore-forming alpha subunit of voltage-gated rapidly inactivating A-type potassium channels. Kv4.2 is highly expressed in the brain (PMID: 10551270). It is a major constituent of A-type potassium currents and a key regulator of neuronal membrane excitability (PMID: 22539834). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15879 Product name: Recombinant human KCND2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 435-630 aa of BC110449 Sequence: AAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL Predict reactive species Full Name: potassium voltage-gated channel, Shal-related subfamily, member 2 Calculated Molecular Weight: 630 aa, 71 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC110449 Gene Symbol: KCND2 Gene ID (NCBI): 3751 RRID: AB_10733102 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZV8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.