Iright
BRAND / VENDOR: Proteintech

Proteintech, 21313-1-AP, FAM124B Polyclonal antibody

CATALOG NUMBER: 21313-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM124B (21313-1-AP) by Proteintech is a Polyclonal antibody targeting FAM124B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21313-1-AP targets FAM124B in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FAM124B is identified as a novel component of CHD7 and CHD8 containing complex. It is a mainly nuclear localized protein with a widespread expressed. Fam124B is a novel protein possibly involved in the pathogenesis of CHARGE syndrome and neurodevelopmental disorders. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15963 Product name: Recombinant human FAM124B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-214 aa of BC025754 Sequence: MDETQGPLAMTVHLLANSGHGSLLQRTLDQLLDCICPEVRLFQVSERASPVKYCEKSHSKRSRFPGMSVLLFLHESPGEDRLFRVLDSLQHSPWQCYPTQDTRGRLCPYFFANQEFYSLDSQLPIWGVRQVHCGSEILRVTLYCSFDNYEDAIRLYEMILQREATLQKSNFCFFVLYASKSFALQLSLKQLPPGMSVDPKESSVLQFKVQEIGQ Predict reactive species Full Name: family with sequence similarity 124B Calculated Molecular Weight: 455 aa, 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC025754 Gene Symbol: FAM124B Gene ID (NCBI): 79843 RRID: AB_10859248 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H5Z6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924