Iright
BRAND / VENDOR: Proteintech

Proteintech, 21322-1-AP, ZNF23 Polyclonal antibody

CATALOG NUMBER: 21322-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF23 (21322-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF23 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 21322-1-AP targets ZNF23 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, A2780 cells, HeLa cells, mouse brain tissue, mouse lung tissue, mouse spleen tissue, SKOV-3 cells Positive IP detected in: mouse brain tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14755 Product name: Recombinant human ZNF23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 294-643 aa of BC007256 Sequence: AYITHQRVHTGEKPYECNDCGKAFNVNAKLIQHQRIHTGEKPYECNECGKGFRCSSQLRQHQSIHTGEKPYQCKECGKGFNNNTKLIQHQRIHTGEKPYECTECGKAFSVKGKLIQHQRIHTGEKPYECNECGKAFRCNSQFRQHLRIHTGEKPYECNECGKAFSVNGKLMRHQRIHTGEKPFECNECGRCFTSKRNLLDHHRIHTGEKPYQCKECGKAFSINAKLTRHQRIHTGEKPFKCMECEKAFSCSSNYIVHQRIHTGEKPFQCKECGKAFHVNAHLIRHQRSHTGEKPFRCVECGKGFSFSSDYIIHQTVHTWKKPYMCSVCGKAFRFSFQLSQHQSVHSEGKS Predict reactive species Full Name: zinc finger protein 23 (KOX 16) Calculated Molecular Weight: 643 aa, 73 kDa Observed Molecular Weight: 73 kDa GenBank Accession Number: BC007256 Gene Symbol: ZNF23 Gene ID (NCBI): 7571 RRID: AB_2878839 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17027 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924