Proteintech, 21329-1-AP, ZNF671 Polyclonal antibody

Size: 20ul / 150ul The ZNF671 (21329-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF671 in WB, IF/ICC, ELISA applications with reactivity to human samples 21329-1-AP targets ZNF671 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells, HeLa cells, MCF-7 cells, MDA-MB-231 cells, SKOV-3 cells, U-251 cells Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15319 Product name: Recombinant human ZNF671 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 207-556 aa of BC025728 Sequence: FDQHQNQPNGGKLFPRKEGRDSVKSCRVHVPEKTLTCGKGRRDFSATSGLLQHQASLSSMKPHKSTKLVSGFLMGQRYHRCGECGKAFTRKDTLARHQRIHTGERPYECNECGKFFSQSYDLFKHQTVHTGERPYECSECGKFFRQISGLIEHRRVHTGERLYQCGKCGKFFSSKSNLIRHQEVHTGARPYVCSECGKEFSRKHTLVLHQRTHTGERPYECSECGKAFSQSSHLNVHWRIHSSDYECSRCGKAFSCISKLIQHQKVHSGEKPYECSKCGKAFTQRPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKLKSVANVGESLRPMPLTYYMVGN Predict reactive species Full Name: zinc finger protein 671 Calculated Molecular Weight: 556 aa, 63 kDa Observed Molecular Weight: 61-70 kDa GenBank Accession Number: BC025728 Gene Symbol: ZNF671 Gene ID (NCBI): 79891 RRID: AB_10755298 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TAW3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.