Product Description
Size: 20ul / 150ul
The WDR82 (21354-1-AP) by Proteintech is a Polyclonal antibody targeting WDR82 in WB, IHC, ELISA applications with reactivity to human, mouse samples
21354-1-AP targets WDR82 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HL-60 cells, Jurkat cells; K-562 cells
Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag15762 Product name: Recombinant human WDR82 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 175-313 aa of BC018941 Sequence: DLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMAFWLPTIDD Predict reactive species
Full Name: WD repeat domain 82
Calculated Molecular Weight: 313 aa, 35 kDa
Observed Molecular Weight: 33-35 kDa
GenBank Accession Number: BC018941
Gene Symbol: WDR82
Gene ID (NCBI): 80335
RRID: AB_3085654
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q6UXN9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924