Iright
BRAND / VENDOR: Proteintech

Proteintech, 21401-1-AP, PAK1 Polyclonal antibody

CATALOG NUMBER: 21401-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PAK1 (21401-1-AP) by Proteintech is a Polyclonal antibody targeting PAK1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 21401-1-AP targets PAK1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C6 cells, Jurkat cells, NIH/3T3 cells, MCF-7 cells, HeLa cells, K-562 cells Positive IP detected in: K-562 cells Positive IHC detected in: mouse brain tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: C6 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The p21-Activated kinase 1 (PAK1), a member of serine-threonine kinases family, was initially identified as an interactor of the Rho GTPases RAC1 and CDC42, which affect a wide range of processes associated with cell motility, survival, metabolism, cell cycle, proliferation, transformation, stress, inflammation, and gene expression(PMID: 32863957). PAK1 is over-expressed in various malignancies such as ovarian, breast, lung, and bladder cancers, and is closely associated with tumor invasion. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16102 Product name: Recombinant human PAK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-65 aa of BC109299 Sequence: APPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTN Predict reactive species Full Name: p21 protein (Cdc42/Rac)-activated kinase 1 Calculated Molecular Weight: 553 aa, 62 kDa Observed Molecular Weight: 61-65 kDa GenBank Accession Number: BC109299 Gene Symbol: PAK1 Gene ID (NCBI): 5058 RRID: AB_11232232 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13153 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924