Iright
BRAND / VENDOR: Proteintech

Proteintech, 21415-1-AP, HIGD2A Polyclonal antibody

CATALOG NUMBER: 21415-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HIGD2A (21415-1-AP) by Proteintech is a Polyclonal antibody targeting HIGD2A in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 21415-1-AP targets HIGD2A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The mammalian HIGD-family proteins include two subgroups of yeast Rcf1 homologs, HIGD1A/B/C and HIGD2A/B. HIGD1A and HIGD2A (of 10.4 and 11.5 kDa, respectively) have two hydrophilic transmembrane domains and are localized in the inner mitochondrial membrane. HIGD1A and HIGD2A expression is induced under stress conditions like hypoxia or glucose deprivation in human cervical epithelial cells and murine cerebral cortical neurons. HIGD1A may play pleiotropic roles in mitochondrial respiratory chain biogenesis. HIGD2A forms a 50 kDa regulatory module with COX4-1, COX5B, and COX6A1, which binds to newly synthesized COX3 to promote its binding to the previously assembled COX1 + COX2 module (PMID:33291261,32375044). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15892 Product name: Recombinant human HIGD2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC007502 Sequence: MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRGNSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP Predict reactive species Full Name: HIG1 hypoxia inducible domain family, member 2A Calculated Molecular Weight: 106 aa, 12 kDa Observed Molecular Weight: 11 kDa, 50 kDa GenBank Accession Number: BC007502 Gene Symbol: HIGD2A Gene ID (NCBI): 192286 RRID: AB_2935453 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BW72 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924