Iright
BRAND / VENDOR: Proteintech

Proteintech, 21438-1-AP, RNF150 Polyclonal antibody

CATALOG NUMBER: 21438-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RNF150 (21438-1-AP) by Proteintech is a Polyclonal antibody targeting RNF150 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21438-1-AP targets RNF150 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, human heart tissue, mouse brain tissue, mouse eye tissue, Y79 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The RING finger (RNF) family, containing the N-terminal RING domain, is the largest E3 ubiquitin ligase family with 340 validated human members (PMID: 25609945). RNF150 proteins belong to the Goliath family and are involved in apoptosis and embryonic development (PMID: 19690564). RNF150 might be involved in the progression of GC partly via heparin binding which correlates well with angiogenesis and hematogenous metastasis (PMID: 37528105). There are four isoforms of RNF150, 48kDa, 44kDa, 43kDa, 32 kDa respectively. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16064 Product name: Recombinant human RNF150 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-211 aa of BC101992 Sequence: LERNITVTMYITIGTRNLQKYVSRTSVVFVSISFIVLMIISLAWLVFYYIQRFRYANARDRNQRRLGDAAKKAISKLQIRTIKKGDKETESDFDNCAVCIEGYKPNDVVRILPCRHLFHK Predict reactive species Full Name: ring finger protein 150 Calculated Molecular Weight: 438 aa, 48 kDa Observed Molecular Weight: 43-44 kDa GenBank Accession Number: BC101992 Gene Symbol: RNF150 Gene ID (NCBI): 57484 RRID: AB_10733469 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULK6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924