Iright
BRAND / VENDOR: Proteintech

Proteintech, 21444-1-AP, Rubicon Polyclonal antibody

CATALOG NUMBER: 21444-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Rubicon (21444-1-AP) by Proteintech is a Polyclonal antibody targeting Rubicon in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21444-1-AP targets Rubicon in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HeLa cells, HepG2 cells Positive IHC detected in: human testis tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Rubicon (Run domain Beclin-1 interacting and cysteine-rich containing protein) consists of an N-terminal RUN domain, a middle region that includes its PI3K-binding domain (PIKBD), a coiled-coil domain (CCD), a serine-rich region (S-R), a helix-coil-rich domain (H-C) and a C-terminal Rubicon homology domain (RH) (PMID: 36288306). Rubicon is ubiquitously expressed in most tissues and organs. Western analysis detected bands at 130~150 kDa due to post-translational modification (PMID: 37898101, 35235784). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, escherichia coli Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13715 Product name: Recombinant human KIAA0226 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 61-290 aa of BC033615 Sequence: VAELWLQHSLQYHCLSAQLRPLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHESPLLVTKSQSLTALPSSTYTPPNSYAQHSYFGSFSSLHQSVPNNGSERRSTSFPLSGPPRKPQESRGHVSPAEDQTIQAPPVSVSALARDSPLTPNEMSSSTLTSPIEASWVSSQNDSPGDASEGPEYLAIGNLDPRGRTASCQSHSSNAESSS Predict reactive species Full Name: KIAA0226 Calculated Molecular Weight: 972 aa, 109 kDa Observed Molecular Weight: 130~150 kDa GenBank Accession Number: BC033615 Gene Symbol: Rubicon Gene ID (NCBI): 9711 RRID: AB_11182941 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92622 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924