Iright
BRAND / VENDOR: Proteintech

Proteintech, 21462-1-AP, MMACHC Polyclonal antibody

CATALOG NUMBER: 21462-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MMACHC (21462-1-AP) by Proteintech is a Polyclonal antibody targeting MMACHC in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21462-1-AP targets MMACHC in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells, HeLa cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MMACHC, also named as CblC, is located on chromosome 1 and comprises four coding exons. Human MMACHC catalyzes the reductive decyanation of cyanocobalamin and may serve as a trafficking chaperone for intracellular cobalamin. It also catalyzes the glutathione-dependent reductive demethylation of methylcobalamin, and, with much lower efficiency, the glutathione-dependent reductive demethylation of adenosylcobalamin. NMACHC binds cyanocobalamin, adenosylcobalamin, methylcobalamin and other, related vitamin B12 derivatives. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15001 Product name: Recombinant human MMACHC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-225 aa of BC006122 Sequence: MFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPASPGP Predict reactive species Full Name: methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria Calculated Molecular Weight: 282 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC006122 Gene Symbol: MMACHC Gene ID (NCBI): 25974 RRID: AB_10732959 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y4U1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924