Proteintech, 21482-1-AP, PLP2 Polyclonal antibody

Size: 20ul / 150ul The PLP2 (21482-1-AP) by Proteintech is a Polyclonal antibody targeting PLP2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 21482-1-AP targets PLP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SMMC-7721 cells, HEK-293 cells, COLO 320 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15740 Product name: Recombinant human PLP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC109066 Sequence: MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV Predict reactive species Full Name: proteolipid protein 2 (colonic epithelium-enriched) Calculated Molecular Weight: 152 aa, 17 kDa Observed Molecular Weight: 15-17 kDa GenBank Accession Number: BC109066 Gene Symbol: PLP2 Gene ID (NCBI): 5355 RRID: AB_10858923 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q04941 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.