Iright
BRAND / VENDOR: Proteintech

Proteintech, 21499-1-AP, SH3D19 Polyclonal antibody

CATALOG NUMBER: 21499-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SH3D19 (21499-1-AP) by Proteintech is a Polyclonal antibody targeting SH3D19 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21499-1-AP targets SH3D19 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-1080 cells, Y79 cells Positive IHC detected in: mouse heart tissue, human heart tissue, human kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SH3D19, also known as EBP, Eve-1, encodes a multiple SH3 domain-containing protein. SH3D19 plays a role in regulating A disintegrin and metalloproteases (ADAMs) in the signaling of EGFR-ligand shedding. SH3D19 is involved in the suppression of Ras-induced cellular transformation and Ras-mediated activation of ELK1(PMID: 14551139). SH3D19 is abundantly expressed in skeletal muscle and heart(PMID: 15280379). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15915 Product name: Recombinant human SH3D19 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 415-764 aa of BC108890 Sequence: VLVMLKQTENNYLECQKGEDTGRVHLSQMKIITPLDEHLRSRPNDPSHAQKPVDSGAPHAVVLHDFPAEQVDDLNLTSGEIVYLLEKIDTDWYRGNCRNQIGIFPANYVKVIIDIPEGGNGKRECVSSHCVKGSRCVARFEYIGEQKDELSFSEGEIIILKEYVNEEWARGEVRGRTGIFPLNFVEPVEDYPTSGANVLSTKVPLKTKKEDSGSNSQVNSLPAEWCEALHSFTAETSDDLSFKRGDRIQILERLDSDWCRGRLQDREGIFPAVFVRPCPAEAKSMLAIVPKGRKAKALYDFRGENEDELSFKAGDIITELESVDDDWMSGELMGKSGIFPKNYIQFLQIS Predict reactive species Full Name: SH3 domain containing 19 Calculated Molecular Weight: 790 aa, 87 kDa Observed Molecular Weight: 45-47 kDa GenBank Accession Number: BC108890 Gene Symbol: SH3D19 Gene ID (NCBI): 152503 RRID: AB_10733218 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5HYK7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924