Proteintech, 21532-1-AP, KNCN Polyclonal antibody

Size: 20ul / 150ul The KNCN (21532-1-AP) by Proteintech is a Polyclonal antibody targeting KNCN in IHC, ELISA applications with reactivity to human, mouse samples 21532-1-AP targets KNCN in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Kinocilin (KNCN) was first detected in the kinocilia of vestibular and auditory hair cells at embryonic days 14.5 and 18.5, respectively. In mature auditory hair cells, KNCN was present at the cuticular plate, at the base of each stereocilium. KNCN was also expressed by the pillar cells and Deiters cells, both of which contain prominent transcellular and apical bundles of microtubules. KNCN expression was detected in both cochlear and vestibular hair cells. KNCN plays a role in stabilizing dense microtubular networks or invesicular trafficking (PMID: 30254566). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16160 Product name: Recombinant human KNCN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-75 aa of BC101295 Sequence: GLLILAYPFLKARFNLDHILPTIGSLRIHPHPGADHGEGRSSTNGNKEGARSSLSTVSRTLEKLKPGTRGAEEC Predict reactive species Full Name: kinocilin Calculated Molecular Weight: 124 aa, 13 kDa GenBank Accession Number: BC101295 Gene Symbol: KNCN Gene ID (NCBI): 148930 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A6PVL3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.