Iright
BRAND / VENDOR: Proteintech

Proteintech, 21586-1-AP, CHRNA7/CHRFAM7A Polyclonal antibody

CATALOG NUMBER: 21586-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHRNA7/CHRFAM7A (21586-1-AP) by Proteintech is a Polyclonal antibody targeting CHRNA7/CHRFAM7A in WB, ELISA applications with reactivity to human samples 21586-1-AP targets CHRNA7/CHRFAM7A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information Neuronal acetylcholine receptor subunit alpha-7, encoded by the CHRNA7 gene, is involved in cognition through interneuron modulation of 4-(2-aminoethyl)benzene-1,2-diol and glutamate signaling. CHRNA7 gene is genetically linked to multiple disorders with cognitive deficits. A partial duplication of CHRNA7 (CHRFAM7A) is found in humans. CHRFAM7A gene encodes the CHRNA7-FAM7A fusion protein. Expression of CHRFAM7A has been reported in brain, peripheral blood lymphocytes (PBLs), and a broad range of epithelial cells (PMID: 21718690; 23553139; 25681457). CHRFAM7A has been associated with many neuropsychiatric disorders (PMID: 25906356; 25701707). This antibody, raised against 241-386 amino acids of human CHRFAM7A protein, recognizes both CHRNA7 and CHRFAM7A. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16151 Product name: Recombinant human CHRFAM7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 241-386 aa of BC101348 Sequence: TRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFS Predict reactive species Full Name: CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion Calculated Molecular Weight: 412 aa, 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC101348 Gene Symbol: CHRNA7/CHRFAM7A Gene ID (NCBI): 89832 RRID: AB_10734326 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q494W8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924